PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G078800.4
Common NameB456_009G078800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 612aa    MW: 67692.8 Da    PI: 8.5147
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G078800.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3711.6e-22173274199
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++ +g ++ p++ ae++      ++++ s++l+ +d++g +W++++i+r++++r++lt+GW+ Fv++++L +gD v+F   +
  Gorai.009G078800.4 173 FCKTLTASDTSIHGGFSAPRRAAEDCfprldYKQTRPSQELVAKDLHGVEWRFRHIFRGQPRRHLLTTGWSVFVSQKNLIAGDAVLFL--R 261
                         99****************************8444556789************************************************..4 PP

                         SSEE..EEEEE-S CS
                  B3  87 rsefelvvkvfrk 99 
                          +++el+++++r+
  Gorai.009G078800.4 262 GEDGELRLGIRRA 274
                         49999*****996 PP

2Auxin_resp113.91.5e-37299380182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         +++a+stk vF+v+Y+Pras++eFv++++k+ k+++++++ G Rf+m+fe++d +err+ G+v+g+ d+dp++WpnSkWr++
  Gorai.009G078800.4 299 VSNALSTKRVFQVCYCPRASHAEFVIPFQKYIKSITNPMCTGARFRMKFEMDDLPERRCNGVVTGIGDSDPYKWPNSKWRCV 380
                         5789*****************************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.8E-39164286IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-41165287IPR015300DNA-binding pseudobarrel domain
CDDcd100177.09E-22171273No hitNo description
PROSITE profilePS5086312.323173275IPR003340B3 DNA binding domain
SMARTSM010193.8E-21173275IPR003340B3 DNA binding domain
PfamPF023625.9E-21173274IPR003340B3 DNA binding domain
PfamPF065079.9E-31300380IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MEIDLNHAVN EVEKTVLCNG SCEKASACVY CLSSSSSSSS SSSSSSSCSS NSGSPPCSSS  60
IDLELWHACA GPLTSLPKKG NVVVYFPQGH LEQLALAFPF SPLDTFDLPP QIFCKVMNVQ  120
LLANKENDEV YTQVTLLPQP ELGGHNLGSK QLDEVGADEH ADGSPSKPTS HMFCKTLTAS  180
DTSIHGGFSA PRRAAEDCFP RLDYKQTRPS QELVAKDLHG VEWRFRHIFR GQPRRHLLTT  240
GWSVFVSQKN LIAGDAVLFL RGEDGELRLG IRRAVRPRTG LPDSVIAKHN SYPKVLSAVS  300
NALSTKRVFQ VCYCPRASHA EFVIPFQKYI KSITNPMCTG ARFRMKFEMD DLPERRCNGV  360
VTGIGDSDPY KWPNSKWRCV MVRWDDDIAS DHQERVSPWE IDPPVFPPPL SIPSPFRLKK  420
LRTGLQTAAL DTPITGFAET NRFPKVLQGQ EICSLRSLTH KADLNLGVWA KTNHGCNSFN  480
MNQAPNTNCY PEGLRNMYFP YNEFYKAGQE PKMFSYASKL PRGNVLFNAS SIKPGVSVDD  540
IRKPNPPNDH KPMENIPSPG FGKKLRNQQN ECYKGNVAGC KLFGFSLTAE SPTLNSQNSG  600
SQARQLGWKS H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-119464032354Auxin response factor 1
4ldy_B1e-119464032354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6277720.0KJ627772.1 Gossypium hirsutum auxin responsive factor ARF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443347.10.0PREDICTED: auxin response factor 4 isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0D2UI980.0A0A0D2UI98_G
STRINGPOPTR_0009s01700.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]